PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG532800.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 548aa    MW: 60896.7 Da    PI: 6.6037
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG532800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox664.9e-211772156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         +++ +++t+ q+++Le++F+++++p++++r +L+++lgL+ rq+k+WFqNrR+++k
  Pavir.1NG532800.2.p 17 KKRYHRHTPRQIQQLEAMFKECPHPDENQRMQLSRELGLEPRQIKFWFQNRRTQMK 72
                         688999***********************************************998 PP

2START152.73.2e-482164412206
                          HHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
                START   2 laeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                          +a +a++el+++a+a++++W + +     e +n d++ ++f++ ++       ++e +r+sg+v+m +  lv  ++d++ +W e ++   
  Pavir.1NG532800.2.p 216 MATRAMDELIRMAQAGDQLWARAAgpdgrEVLNVDTYDSIFSKPGSsfrgpdVHVEGSRDSGLVFMSAIGLVDMFMDSS-KWMEFFPaiv 304
                          5789********************999999999999999997766699*******************************.********** PP

                          .EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--...-TTSEE-EESSEEEEEEEEC CS
                START  78 .kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe..sssvvRaellpSgiliepks 158
                            a t++v+ +g     g l+lm+ el ++sp+vp R+  f+Ry+rq + g w+i+dvSvd + +          R+ +lpSg+li +++
  Pavir.1NG532800.2.p 305 sNARTIDVLVNGmagrsGSLVLMYEELHVMSPVVPtRELCFLRYCRQIEHGLWAIADVSVDLQPCDARfgA--PPRSCRLPSGCLIADMA 392
                          9************************************************************9999887432..357779*********** PP

                          TCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 159 nghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                          ng+skvtwveh+++++r+p h l+r l+ sg+a+ga +w+a+lqr ce+
  Pavir.1NG532800.2.p 393 NGYSKVTWVEHMEVEDRVPiHLLYRDLILSGAAFGAHRWLAALQRACER 441
                          ***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.34E-20674IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-221280IPR009057Homeodomain-like
PROSITE profilePS5007117.8151474IPR001356Homeobox domain
SMARTSM003891.6E-191578IPR001356Homeobox domain
CDDcd000866.83E-201675No hitNo description
PfamPF000461.5E-181772IPR001356Homeobox domain
PROSITE patternPS0002704972IPR017970Homeobox, conserved site
PROSITE profilePS5084844.182206444IPR002913START domain
SuperFamilySSF559613.08E-32207442No hitNo description
CDDcd088752.97E-109210440No hitNo description
SMARTSM002348.0E-39215441IPR002913START domain
PfamPF018522.1E-40216441IPR002913START domain
Gene3DG3DSA:3.30.530.206.1E-5323411IPR023393START-like domain
SuperFamilySSF559611.1E-6459545No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MDFGDDVMDG SDAQHRKKRY HRHTPRQIQQ LEAMFKECPH PDENQRMQLS RELGLEPRQI  60
KFWFQNRRTQ MKAQHERQDN CFLRAENDKI RCENIAMREA LRNVICPTCG GPPVADDYFD  120
EQKLRMENAR LKEELDRVSS LTSKYLGRPF TQLPPVQPLS MSSSLDLSVG GLGSPALGPS  180
LDLDLLSGGS SGYGHHPAFH LPTAVPEMER PMMAEMATRA MDELIRMAQA GDQLWARAAG  240
PDGREVLNVD TYDSIFSKPG SSFRGPDVHV EGSRDSGLVF MSAIGLVDMF MDSSKWMEFF  300
PAIVSNARTI DVLVNGMAGR SGSLVLMYEE LHVMSPVVPT RELCFLRYCR QIEHGLWAIA  360
DVSVDLQPCD ARFGAPPRSC RLPSGCLIAD MANGYSKVTW VEHMEVEDRV PIHLLYRDLI  420
LSGAAFGAHR WLAALQRACE RCACLATAGM PPRDIAGVTP EGNRSMMKLS QRMVSGFCAS  480
LSASQLHRWT TLSGPNDVGV RVMVHRSTDP GQPSGVVLSA ATSIWLPVPC DRVFAFICDE  540
NTRSQVP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7285230.0KJ728523.1 Zea mays clone pUT6828 HB transcription factor (HB83) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954072.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLK3YQE00.0K3YQE0_SETIT; Uncharacterized protein
STRINGSi016483m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11